DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and Arl6

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_006248253.1 Gene:Arl6 / 363760 RGDID:1305535 Length:193 Species:Rattus norvegicus


Alignment Length:184 Identity:58/184 - (31%)
Similarity:90/184 - (48%) Gaps:30/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSK-----ITTTVGLNIGTIDVQGVRLNF 73
            :|.:..|:.|||||:||||.:..           |.||.     |..|:|.:|.......:....
  Rat    14 KKKEVHVLCLGLDNSGKTTIINK-----------LKPSNAQVQDIVPTIGFSIEKFKSSSLSFTV 67

  Fly    74 WDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLS--GVPLLILANKQ 136
            :|:.||...::||:.||::...:|:|:||:|:.||..:|...|.::.:..:.  .:|:|..|||.
  Rat    68 FDMSGQGRYRNLWEHYYKDGQAIIFVVDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKM 132

  Fly   137 DLPDVMGVREIKPVFQQAGALIGRRD-----CLTIPVSALHGEGVDEGIKWLVE 185
            ||.|  .|..:|  ..|...|...:|     |.:   .||.|||:.||:.||.|
  Rat   133 DLRD--AVTSVK--VSQLLCLENIKDKPWHICAS---DALKGEGLQEGVDWLQE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 54/175 (31%)
Arfrp1 19..186 CDD:206725 57/179 (32%)
Arl6XP_006248253.1 SAR 11..179 CDD:197556 57/182 (31%)
Arl6 19..180 CDD:206722 57/179 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.