DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and Arl13b

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_038944319.1 Gene:Arl13b / 304037 RGDID:1584979 Length:484 Species:Rattus norvegicus


Alignment Length:203 Identity:67/203 - (33%)
Similarity:110/203 - (54%) Gaps:25/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYTLMHG----FYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNI 61
            |:.||..    |.::........:|::||||||        ||...:..:|.:|..:..|||.: 
  Rat     1 MFNLMANCCNLFKRWREPVRKVTLVMVGLDNAG--------KTATAKGIQGEHPEDVAPTVGFS- 56

  Fly    62 GTIDV-QG-VRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELL 124
             .||: || ..:..:||||.:.::.:|..||.||:|||:|:||:|.:||||:|....:::::..:
  Rat    57 -KIDLRQGKFEVTIFDLGGGKRIRGIWKNYYAESYGVIFVVDSSDEDRMEETKETMSEVLRHPRI 120

  Fly   125 SGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCL--TIPVSAL--HGEGVDEGIK---- 181
            ||.|:|:||||||....:|..::.... ....|:....||  ..|.||:  :|:.:|:.||    
  Rat   121 SGKPILVLANKQDKEGALGEADVIECL-SLEKLVNEHKCLCQIEPCSAVLGYGKKIDKSIKKGLY 184

  Fly   182 WLVEAIKR 189
            ||:..|.:
  Rat   185 WLLHIIAK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 58/169 (34%)
Arfrp1 19..186 CDD:206725 62/176 (35%)
Arl13bXP_038944319.1 Arl2l1_Arl13_like 23..189 CDD:133361 62/176 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.