DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and Arl11

DIOPT Version :10

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_796311.2 Gene:Arl11 / 219144 MGIID:2444054 Length:176 Species:Mus musculus


Alignment Length:173 Identity:59/173 - (34%)
Similarity:98/173 - (56%) Gaps:17/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITT--TVGLNIGTIDVQG-VRLNFWDLGGQQE 81
            ||::|||:|||||.|          ||......:.|  |||.|:..::..| |.|..||:|||.:
Mouse    15 VVMMGLDSAGKTTIL----------YKLKGNQLVDTLPTVGFNVEPLEAPGHVSLTLWDIGGQTQ 69

  Fly    82 LQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVRE 146
            |::.|..|.:....::||:||.|..|:.|:.|...:::::..::|||.|:|||||:.|..:.:.|
Mouse    70 LRATWKDYLEGIDLLVYVLDSTDEARLPEAVAELKEVLEDPNMAGVPFLVLANKQEAPGALPLLE 134

  Fly   147 IKPVFQQAGALIGRRDCLTI-PVSALHGEGVDEGIKWLVEAIK 188
            |:   .:.|....::.|..: ..|||.|:|:.|.::.|:..:|
Mouse   135 IR---NRLGLEGFQKHCWELRACSALTGQGLQEALQSLLHLLK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 Arfrp1 19..186 CDD:206725 58/169 (34%)
Arl11NP_796311.2 P-loop containing Nucleoside Triphosphate Hydrolases 14..169 CDD:476819 57/166 (34%)

Return to query results.
Submit another query.