DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and ARL13B

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001167621.1 Gene:ARL13B / 200894 HGNCID:25419 Length:428 Species:Homo sapiens


Alignment Length:201 Identity:66/201 - (32%)
Similarity:104/201 - (51%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYTLMHG----FYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNI 61
            |::||..    |.::........::::||||||        ||...:..:|..|..:..|||.:.
Human     1 MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAG--------KTATAKGIQGEYPEDVAPTVGFSK 57

  Fly    62 GTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSG 126
            ..:......:..:||||...::.:|..||.||:|||:|:||:|.|||||:|....:|:::..:||
Human    58 INLRQGKFEVTIFDLGGGIRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLRHPRISG 122

  Fly   127 VPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCL--TIPVSALHGEG--VDEGIK----WL 183
            .|:|:||||||....:|..::.... ....|:....||  ..|.||:.|.|  :|:.||    ||
Human   123 KPILVLANKQDKEGALGEADVIECL-SLEKLVNEHKCLCQIEPCSAISGYGKKIDKSIKKGLYWL 186

  Fly   184 VEAIKR 189
            :..|.|
Human   187 LHVIAR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 56/167 (34%)
Arfrp1 19..186 CDD:206725 60/174 (34%)
ARL13BNP_001167621.1 Arl2l1_Arl13_like 23..189 CDD:133361 60/174 (34%)
RNase_E_G <198..>259 CDD:331378
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..287
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.