Sequence 1: | NP_572526.1 | Gene: | Arfrp1 / 31841 | FlyBaseID: | FBgn0030088 | Length: | 200 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001167621.1 | Gene: | ARL13B / 200894 | HGNCID: | 25419 | Length: | 428 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 66/201 - (32%) |
---|---|---|---|
Similarity: | 104/201 - (51%) | Gaps: | 21/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MYTLMHG----FYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNI 61
Fly 62 GTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSG 126
Fly 127 VPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCL--TIPVSALHGEG--VDEGIK----WL 183
Fly 184 VEAIKR 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Arfrp1 | NP_572526.1 | small_GTP | 17..181 | CDD:272973 | 56/167 (34%) |
Arfrp1 | 19..186 | CDD:206725 | 60/174 (34%) | ||
ARL13B | NP_001167621.1 | Arl2l1_Arl13_like | 23..189 | CDD:133361 | 60/174 (34%) |
RNase_E_G | <198..>259 | CDD:331378 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 207..287 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 318..428 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0076 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |