DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and arl-6

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_497993.1 Gene:arl-6 / 183311 WormBaseID:WBGene00000193 Length:190 Species:Caenorhabditis elegans


Alignment Length:200 Identity:65/200 - (32%)
Similarity:104/200 - (52%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GFYKYMTQ-----KDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDV 66
            ||:..::.     |.|..:|::||||:||||.|...||..||:      .:|..|||..:.....
 Worm     2 GFFSSLSSLFGLGKKDVNIVVVGLDNSGKTTILNQLKTPETRS------QQIVPTVGHVVTNFST 60

  Fly    67 QGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELL------- 124
            |.:..:.:|:.||.:.:|.|:.|:..|.|||:|:||:||.|||        ::|:||:       
 Worm    61 QNLSFHAFDMAGQMKYRSTWESYFHSSQGVIFVLDSSDRLRME--------LLKDELMMVMEHKD 117

  Fly   125 ---SGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCLTI-PVSALHGEGVDEGIKWLVE 185
               .|:|::|||||.|:|..|...:|....   |..:.|....:| ...||.|:|:|:.::.|..
 Worm   118 VVSRGIPIVILANKMDIPGAMTASDITVAL---GLNLYRSGTWSIHSTCALTGDGLDKAMQQLSA 179

  Fly   186 AIKRH 190
            .|.::
 Worm   180 EITKY 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 60/174 (34%)
Arfrp1 19..186 CDD:206725 60/177 (34%)
arl-6NP_497993.1 small_GTP 17..173 CDD:272973 60/172 (35%)
Arl6 19..180 CDD:206722 60/177 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.