DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and Arl14

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_008759336.1 Gene:Arl14 / 103690167 RGDID:9465124 Length:192 Species:Rattus norvegicus


Alignment Length:180 Identity:65/180 - (36%)
Similarity:109/180 - (60%) Gaps:17/180 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTTY---LEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQ-GVRLNFWDLGGQQ 80
            :::||||:|||:|.   |:.|:|..|           ..|:|.|:..:.:| |:.|..||:|||:
  Rat    16 ILLLGLDSAGKSTLLYRLKFAETLAT-----------IPTIGFNVEMVQLQSGLALTVWDIGGQE 69

  Fly    81 ELQSLWDKYYQESHGVIYVID-SNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGV 144
            :::::||.|.:.:||::||:| |..::|:|:|:..|..::|||.:...|::|||||||||..:..
  Rat    70 KMRTVWDCYCENAHGLVYVVDCSEGQKRLEDSRKEFKHILKNEHIKNTPVVILANKQDLPGALSA 134

  Fly   145 REIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKRHAVVR 194
            .:|..:| :...|...|:....|..|:.|||:|:|.:.|.|.:|.|...|
  Rat   135 EDITRMF-KVKKLCSDRNWYVQPCCAVTGEGLDDGFRKLTEFVKSHLKTR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 60/165 (36%)
Arfrp1 19..186 CDD:206725 61/170 (36%)
Arl14XP_008759336.1 ARLTS1 15..175 CDD:133356 61/170 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.