DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfrp1 and arl13a

DIOPT Version :9

Sequence 1:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_004916817.1 Gene:arl13a / 100499404 XenbaseID:XB-GENE-1007191 Length:422 Species:Xenopus tropicalis


Alignment Length:182 Identity:50/182 - (27%)
Similarity:95/182 - (52%) Gaps:27/182 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWDL------GG 78
            ::.||||||||::.:        |..:.:.|.::.::..::....:   :||:.:||      ||
 Frog    51 IIFLGLDNAGKSSII--------RVIRRVPPCQVLSSAHVDPFRTE---IRLDRFDLTLLEMPGG 104

  Fly    79 QQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMG 143
            |:...| |..||.::|.:::|:|::|..||:|...:...::::..::|.||||||||||....:.
 Frog   105 QKNRAS-WRLYYTQAHALVFVVDASDPGRMKEVACVLASVLRHPCVAGKPLLILANKQDKSSSLL 168

  Fly   144 VREIKPVFQQAGALI--GRRDCLTIPVSA------LHGEGVDEGIKWLVEAI 187
            ..||..:. ....|:  .:..|...|.||      .|..||.:.::|::.::
 Frog   169 TSEIIELL-SLETLVNENKTHCRIEPCSAGAEFSSQHDWGVLKALRWVLRSV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 49/174 (28%)
Arfrp1 19..186 CDD:206725 50/179 (28%)
arl13aXP_004916817.1 P-loop_NTPase 50..217 CDD:393306 50/178 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.