DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPD and sqd

DIOPT Version :9

Sequence 1:NP_112738.1 Gene:HNRNPD / 3184 HGNCID:5036 Length:355 Species:Homo sapiens
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:306 Identity:124/306 - (40%)
Similarity:177/306 - (57%) Gaps:31/306 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    51 TASG-GTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQR-EEWKMFIGGLSWDTTKKDL 113
            ||.| |:|.|.|.:.|:             :|.|..:..||:.|| ::.|:|:|||||:||:|:|
  Fly    21 TADGPGSENGDAGAAGS-------------TNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKEL 72

Human   114 KDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTK 178
            :|:|.|:||:....:|.||.|||||||.|::|..:|::|||....||.:|.|.:|||:|||..  
  Fly    73 RDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH-- 135

Human   179 EPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKK 243
               .|||||||:.:..:|:|:.|||.||.:..:|:|.|.:.::|:|||||||..|:.|..:::..
  Fly   136 ---GKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTP 197

Human   244 YHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYN 308
            ...:...:.::|.|..|.  :.|...|.|||..|..||..||  .....||:|.|: |.|:||  
  Fly   198 KQKIAGKEVDVKRATPKP--ENQMMGGMRGGPRGGMRGGRGG--YGGRGGYNNQWD-GQGSYG-- 255

Human   309 SQGY-GGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQ-NSY 352
              || ||||||...||.:||..|.|:....||......||.: |.|
  Fly   256 --GYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGY 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPDNP_112738.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 12/41 (29%)
CBFNT <60..78 CDD:311868 2/17 (12%)
RRM1_hnRNPD 99..172 CDD:410150 38/72 (53%)
RRM2_hnRNPD 183..257 CDD:241027 28/73 (38%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 36/70 (51%)
RRM2_hnRNPD_like 137..211 CDD:240775 28/73 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8162
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3498
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45859
OrthoDB 1 1.010 - - D1055256at2759
OrthoFinder 1 1.000 - - FOG0001417
OrthoInspector 1 1.000 - - oto91036
orthoMCL 1 0.900 - - OOG6_112757
Panther 1 1.100 - - O PTHR48033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X985
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.