DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT2 and RpLP1

DIOPT Version :9

Sequence 1:NP_572524.1 Gene:CCT2 / 31838 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster


Alignment Length:44 Identity:11/44 - (25%)
Similarity:19/44 - (43%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 NARILIANTPMDTDKIKVFGSSIKVDSLAKIADLEMAEKEKMKE 277
            |.:.||.|...........|::....:.|..|:.:..||:|.:|
  Fly    55 NVKDLITNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 11/44 (25%)
TCP1_beta 10..527 CDD:239452 11/44 (25%)
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.820802 Normalized mean entropy S11
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.