DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and CDY2A

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_004816.1 Gene:CDY2A / 9426 HGNCID:1810 Length:541 Species:Homo sapiens


Alignment Length:272 Identity:68/272 - (25%)
Similarity:104/272 - (38%) Gaps:76/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKR-TVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESLKNNKKETKK-- 63
            ||.||.:.||| ..||.|:|.::||||.:.::||||.::| :|...:.:|      |:::|:|  
Human     5 EFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDF------NRRQTEKQK 63

  Fly    64 -----------------RLSTSSTPESIRSKRKSFLEDDTEEQK--KLIGFERGL--EASKILG- 106
                             |.|.|:.....::..|:.:.|.....|  ||....:.:  :|:..|. 
Human    64 KLTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNCKLFAASKNVRRKAASTLSD 128

  Fly   107 --------------ATDSS-GHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERL----TW 152
                          |.||. .|...:..::..:..|.:.|...:|    ||.:..|.:|    ..
Human   129 TKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDT----VVFKVTEGKLLRDPLS 189

  Fly   153 HTGS-GNGNGNTNSVNLGSSGGLGSVGGSGA-GDDTAPGSV---------GTT----------GG 196
            |.|: ..|..|...::...|...|||..|.| |..|..|.|         |||          ||
Human   190 HPGAEQTGIQNKTQMHPLMSQMSGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGG 254

  Fly   197 GSNIDGGDEEDP 208
            ..||.......|
Human   255 QRNITDDSRGQP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 22/50 (44%)
Chromo_shadow 100..151 CDD:279701 13/70 (19%)
CDY2ANP_004816.1 CHROMO 5..58 CDD:214605 23/58 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..104 5/31 (16%)
crotonase-like 287..483 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.