Sequence 1: | NP_001162713.1 | Gene: | HP1b / 31834 | FlyBaseID: | FBgn0030082 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003646.2 | Gene: | CBX4 / 8535 | HGNCID: | 1554 | Length: | 560 | Species: | Homo sapiens |
Alignment Length: | 248 | Identity: | 52/248 - (20%) |
---|---|---|---|
Similarity: | 74/248 - (29%) | Gaps: | 110/248 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTS 68
Fly 69 STPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKL 133
Fly 134 ANTRCPQVVIQFYEERLTWHTG-SGNGNGNTNSVNLGSSGGLGSVGGSG---------------- 181
Fly 182 ----AGDDTAPGSVGTTGGGSN-----------------IDGGDEEDPEPASP 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HP1b | NP_001162713.1 | CHROMO | 3..52 | CDD:214605 | 23/47 (49%) |
Chromo_shadow | 100..151 | CDD:279701 | 5/50 (10%) | ||
CBX4 | NP_003646.2 | Interaction with BMI1 | 1..539 | 52/248 (21%) | |
Involved in interaction with H3C15 and H3C1. /evidence=ECO:0000269|PubMed:18927235 | 1..75 | 28/119 (24%) | |||
CHROMO | 10..62 | CDD:214605 | 23/83 (28%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 92..152 | 13/64 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 217..243 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 281..404 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 509..528 | ||||
Involved in interaction with H3C15 and RNF2. /evidence=ECO:0000269|PubMed:18927235 | 531..556 | ||||
CBX7_C | <538..559 | CDD:319236 | |||
Interaction with RNF2 | 540..560 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628171at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |