DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and CBX4

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_003646.2 Gene:CBX4 / 8535 HGNCID:1554 Length:560 Species:Homo sapiens


Alignment Length:248 Identity:52/248 - (20%)
Similarity:74/248 - (29%) Gaps:110/248 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTS 68
            |:||.:|.||...||.||.:||:|:....|||||.||:..|.|:..|:                 
Human    11 FAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQ----------------- 58

  Fly    69 STPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKL 133
                            :.|.|::|:|:.:                       :|.....||    
Human    59 ----------------NRERQEQLMGYRK-----------------------RGPKPKPLV---- 80

  Fly   134 ANTRCPQVVIQFYEERLTWHTG-SGNGNGNTNSVNLGSSGGLGSVGGSG---------------- 181
                   |.:..:..|....|| ..:...|...::||:.|     .|.|                
Human    81 -------VQVPTFARRSNVLTGLQDSSTDNRAKLDLGAQG-----KGQGHQYELNSKKHHQYQPH 133

  Fly   182 ----AGDDTAPGSVGTTGGGSN-----------------IDGGDEEDPEPASP 213
                ||....||..|......|                 ..||.:|.|.|..|
Human   134 SKERAGKPPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 23/47 (49%)
Chromo_shadow 100..151 CDD:279701 5/50 (10%)
CBX4NP_003646.2 Interaction with BMI1 1..539 52/248 (21%)
Involved in interaction with H3C15 and H3C1. /evidence=ECO:0000269|PubMed:18927235 1..75 28/119 (24%)
CHROMO 10..62 CDD:214605 23/83 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..152 13/64 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..243
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..404
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..528
Involved in interaction with H3C15 and RNF2. /evidence=ECO:0000269|PubMed:18927235 531..556
CBX7_C <538..559 CDD:319236
Interaction with RNF2 540..560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.