DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and TFL2

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001330016.1 Gene:TFL2 / 831635 AraportID:AT5G17690 Length:452 Species:Arabidopsis thaliana


Alignment Length:222 Identity:53/222 - (23%)
Similarity:84/222 - (37%) Gaps:60/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKW-------KGYPRSENTWEPVENL-DCPDLIANFEESLKNNKKE 60
            :.:|.:..||...|:.:|.:|.       :|:|.:.|||||:||| ...|:|..||.|||..|..
plant   108 YEIEAIRRKRVRKGKVQYLIKCYKLGCERRGWPETANTWEPLENLQSIADVIDAFEGSLKPGKPG 172

  Fly    61 TKKRLSTSSTPESIRSKRK--SFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGS 123
            .|::...:.....::.|::  |...|.||:                   :|||..|.........
plant   173 RKRKRKYAGPHSQMKKKQRLTSTSHDATEK-------------------SDSSTSLNNSSLPDIP 218

  Fly   124 DHADLVPAKLANTRCPQVVIQFYEERLTWHTGS------------------------GNGNGNTN 164
            |..||..:.|.| |..:....:...::..::||                        |..| |:|
plant   219 DPLDLSGSSLLN-RDVEAKNAYVSNQVEANSGSVGMARQVRLIDNEKEYDPTLNELRGPVN-NSN 281

  Fly   165 SVNLGSSGGLGSVGGSGAGDDTAPGSV 191
            .......||:||     .||:..|..:
plant   282 GAGCSQGGGIGS-----EGDNVRPNGL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 19/55 (35%)
Chromo_shadow 100..151 CDD:279701 10/50 (20%)
TFL2NP_001330016.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3809
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.