DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and cbx8b

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001019586.1 Gene:cbx8b / 799361 ZFINID:ZDB-GENE-050522-325 Length:361 Species:Danio rerio


Alignment Length:82 Identity:27/82 - (32%)
Similarity:40/82 - (48%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNK----KETKKR 64
            |:.|.:..:|...|..||.:||||:....:||||.||:..|.|...|||..:..:    |:...:
Zfish    11 FAAESIIKRRIRRGHMEYLVKWKGWSPKYSTWEPEENILDPRLFVAFEEREREREIFGPKKRGPK 75

  Fly    65 LSTSSTPESIRSKRKSF 81
            |.|.......:.|.||:
Zfish    76 LKTFLLKAQAKEKAKSY 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 19/47 (40%)
Chromo_shadow 100..151 CDD:279701
cbx8bNP_001019586.1 Chromo 14..57 CDD:278797 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.