DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and cbx5

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001073653.1 Gene:cbx5 / 563396 ZFINID:ZDB-GENE-030131-5553 Length:204 Species:Danio rerio


Alignment Length:172 Identity:90/172 - (52%)
Similarity:111/172 - (64%) Gaps:21/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLST 67
            |:.||:|.|:|.|.||.||:|||||:....|||||.:|||||:||:.|.::.|.....:.....:
Zfish    20 EYVVEKVLDRRVVKGRVEYFLKWKGFTEKHNTWEPEKNLDCPELISEFMKTYKKGNSASPPSSKS 84

  Fly    68 SST-PESIR----------SKRKSFLEDD--------TEEQKKLI--GFERGLEASKILGATDSS 111
            ||| |.|.|          ||||:..|::        .:|.:.|:  |||||||..||:|||||.
Zfish    85 SSTGPSSARPKDSSGSSSTSKRKNSEEENGSSSKPKKKKEDEILVARGFERGLEPEKIIGATDSC 149

  Fly   112 GHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTWH 153
            |.||||||||.||.||||.||.||.:|||:||.|||||||||
Zfish   150 GDLMFLMKWKDSDEADLVLAKEANHKCPQIVIAFYEERLTWH 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 29/48 (60%)
Chromo_shadow 100..151 CDD:279701 37/50 (74%)
cbx5NP_001073653.1 Chromo 21..69 CDD:306815 28/47 (60%)
Chromo_shadow 138..190 CDD:307518 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7663
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52905
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm25057
orthoMCL 1 0.900 - - OOG6_104220
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.