DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and MPHOSPH8

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_011533426.1 Gene:MPHOSPH8 / 54737 HGNCID:29810 Length:879 Species:Homo sapiens


Alignment Length:95 Identity:31/95 - (32%)
Similarity:52/95 - (54%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESLKNNK-KETKKRLS 66
            |.||::.|.:|..|:..|.::||||...::||||..:| ||.:::..|.:.:..|| |..:|.:.
Human    59 FEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAKAVRKDIQ 123

  Fly    67 TSSTPESI-----RSKRKSFLEDDTEEQKK 91
            ..|....|     .|.::|..::||..:||
Human   124 RLSLNNDIFEANSDSDQQSETKEDTSPKKK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 19/48 (40%)
Chromo_shadow 100..151 CDD:279701
MPHOSPH8XP_011533426.1 CHROMO 57..109 CDD:237991 19/49 (39%)
ANK 595..719 CDD:238125
ANK repeat 600..631 CDD:293786
Ank_2 606..695 CDD:289560
ANK repeat 633..664 CDD:293786
ANK repeat 666..695 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.