DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Cbx7

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006521207.1 Gene:Cbx7 / 52609 MGIID:1196439 Length:251 Species:Mus musculus


Alignment Length:244 Identity:57/244 - (23%)
Similarity:88/244 - (36%) Gaps:56/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLS-- 66
            |:||.:..||...|:.||.:||||:|...:||||.|::..|.|:..:||      ||.:.|.|  
Mouse    11 FAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEE------KEERDRASGY 69

  Fly    67 TSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLV-- 129
            ....|:..|...:.....|.....|..|.|:   ....|.....||..|.::|   :..|:||  
Mouse    70 RKRGPKPRRLLLQRLYSMDLRSSHKAKGNEK---LCFSLARPLRSGSPMGVVK---AGVAELVEK 128

  Fly   130 -------PAKLANTRCPQVVIQFYEERLTWHTGSGNGNGNTNSVNLGSSGGLGSVGGSGAGDDTA 187
                   |..|...|.....::...::..........:.:...::|..|              .|
Mouse   129 GPLVPTLPFPLRKARKAHKYLRLSRKKFPPRGPHLESHSHRRELSLQES--------------AA 179

  Fly   188 PGSVGTTGGGSNIDGGDEEDPEPASPIGSINQDENIKPDESSELDNGQP 236
            |..|.|.|....::...||:.|                   ::|.||.|
Mouse   180 PDVVQTPGDWEPMEQAPEEEAE-------------------ADLTNGPP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 20/47 (43%)
Chromo_shadow 100..151 CDD:279701 11/59 (19%)
Cbx7XP_006521207.1 CD_Cbx7 7..62 CDD:349293 23/56 (41%)
CBX7_C 209..240 CDD:375056 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.