DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and mphosph8

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001119905.1 Gene:mphosph8 / 504061 ZFINID:ZDB-GENE-050309-191 Length:946 Species:Danio rerio


Alignment Length:138 Identity:34/138 - (24%)
Similarity:56/138 - (40%) Gaps:38/138 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESL------------- 54
            :.|||:.|.|...|...|.::||.|...::||||..:| ||.:::..::::|             
Zfish    21 YEVERIIDVRVEEGEVLYRVRWKNYSSEDDTWEPEAHLDDCKEVLLAYKKALAELKPKKEPAMLP 85

  Fly    55 ------------------------KNNKKETKKRLSTSSTPESIRSKRKSFLEDDTEEQKKLIGF 95
                                    |..||:.||::..|....|:|.|:|...::...|.|.|...
Zfish    86 MKSDLFDADSESDSDKEKPKESPMKKKKKKKKKKIEDSDDEMSVREKKKKKKKEKWREDKPLPAP 150

  Fly    96 ERGLEASK 103
            |...|.|:
Zfish   151 ESDEEESR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 17/48 (35%)
Chromo_shadow 100..151 CDD:279701 2/4 (50%)
mphosph8NP_001119905.1 CHROMO 20..70 CDD:214605 17/48 (35%)
ANK repeat 654..684 CDD:293786
ANK 681..805 CDD:238125
Ank_2 693..781 CDD:289560
ANK repeat 719..750 CDD:293786
ANK repeat 752..781 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.