DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and rhi

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster


Alignment Length:248 Identity:61/248 - (24%)
Similarity:101/248 - (40%) Gaps:24/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFE-ESLKNNKKETKKRL 65
            |:.||::..||.||||.:..:||.|:|...|||||:||: :|..|:::|| |..:.::|...|.:
  Fly    23 EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSV 87

  Fly    66 STSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVP 130
            ..|.:..|  |......|:.....||.....:.::|....|        |..|..|...:.....
  Fly    88 GKSKSSPS--SSGPLITENGPSSSKKTQQHSKSVQAKNTAG--------MSKMNQKKGKNIKKTA 142

  Fly   131 AKLAN-TRCPQVVIQFYEERLTWHTGSGNGNGNTNSVNLGSSGGLGSV-GGSGAGDDTAPGSVGT 193
            .|:.: ...|:..:....:..|..|...:||.:..:.|:..|..:.|: ......:.|....||.
  Fly   143 GKIKDIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDVGD 207

  Fly   194 TG------GGSNIDGGDEEDPEPASPIGSINQDENIKPDESSELDNGQPDADD 240
            |.      ....|:....||    :|:.|.:....:...||..|.:...|..|
  Fly   208 TSLKTPPKSRRLIEFPQRED----APLSSKHVSPMLIRKESQPLQSSCTDDSD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 24/50 (48%)
Chromo_shadow 100..151 CDD:279701 7/51 (14%)
rhiNP_536794.1 CHROMO 22..72 CDD:237991 22/48 (46%)
ChSh 357..411 CDD:294039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.