DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and HP1c

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster


Alignment Length:146 Identity:62/146 - (42%)
Similarity:92/146 - (63%) Gaps:20/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKR-TVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLST 67
            |.|||:.||| |..|:.|||:||:||..::|||||.||.|||:||..||||...:||..:|:   
  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAKSKKRGEKK--- 69

  Fly    68 SSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAK 132
               |:             .||.:||.|:|||||.::|:||||.:|.:.:|::|:..|..||||:.
  Fly    70 ---PK-------------CEEIQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSA 118

  Fly   133 LANTRCPQVVIQFYEE 148
            ....:.||::|.::::
  Fly   119 QIVEKDPQMLIDYFQK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 29/48 (60%)
Chromo_shadow 100..151 CDD:279701 17/49 (35%)
HP1cNP_651093.1 Chromo 9..58 CDD:278797 29/48 (60%)
Chromo_shadow 89..134 CDD:279701 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441209
Domainoid 1 1.000 61 1.000 Domainoid score I3809
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3624
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114392at33392
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - mtm4828
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
109.900

Return to query results.
Submit another query.