DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and cbx1b

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001002090.1 Gene:cbx1b / 415180 ZFINID:ZDB-GENE-040625-68 Length:203 Species:Danio rerio


Alignment Length:152 Identity:89/152 - (58%)
Similarity:107/152 - (70%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLST 67
            |:.||:|.|:|.|.|:.||.|||||:...:|||||.||||||||||.|.:|.|..:...|:|..|
Zfish    47 EYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPDENLDCPDLIAEFLQSQKTAESGGKRRAET 111

  Fly    68 SSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAK 132
            ....:..: |||       :|.:||.||.|||:..:|:|||||||.||||||||.||.|||||||
Zfish   112 DGDGKETK-KRK-------DEPEKLRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAK 168

  Fly   133 LANTRCPQVVIQFYEERLTWHT 154
            .||.:||||||.|||||||||:
Zfish   169 EANVKCPQVVISFYEERLTWHS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 31/48 (65%)
Chromo_shadow 100..151 CDD:279701 38/50 (76%)
cbx1bNP_001002090.1 Chromo 54..97 CDD:278797 27/42 (64%)
Chromo_shadow 136..187 CDD:279701 38/50 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7663
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H89116
Inparanoid 1 1.050 183 1.000 Inparanoid score I3949
OMA 1 1.010 - - QHG52905
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm25057
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.