DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Pc

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster


Alignment Length:265 Identity:58/265 - (21%)
Similarity:95/265 - (35%) Gaps:52/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKET-----KK 63
            ::.|::..||...|..||.:||||:.:..|||||..|:....||..:|::.|::...:     ||
  Fly    26 YAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKKK 90

  Fly    64 RLSTSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWK-----GS 123
            .......||| .....:|.|:|.:..:               ..|.|:.|.....|.|     ..
  Fly    91 EKEPDPEPES-EEDEYTFTENDVDTHQ---------------ATTSSATHDKESKKEKKHHHHHH 139

  Fly   124 DHADLVPAKLANTRCPQVVIQFY--------EERLTWHTGSGNGNGNTNSV------NLGSSGGL 174
            .|..:...:.:..|....:...:        .:|:. |:.|.|.:...||.      |..||...
  Fly   140 HHHHIKSERNSGRRSESPLTHHHHHHHHESKRQRID-HSSSSNSSFTHNSFVPEPDSNSSSSEDQ 203

  Fly   175 GSVGGSGAGDD-TAPGSVGTTGGGSNIDGGDEEDPEPA--------SPIGSINQDENIKPDESSE 230
            ..:|.....:. ...|.:|.|...|  ..|....|:|.        .|.....|.|.|..:.:::
  Fly   204 PLIGTKRKAEVLKESGKIGVTIKTS--PDGPTIKPQPTQQVTPSQQQPFQDQQQAEKIASEAATQ 266

  Fly   231 LDNGQ 235
            |.:.|
  Fly   267 LKSEQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 18/47 (38%)
Chromo_shadow 100..151 CDD:279701 8/63 (13%)
PcNP_524199.1 CHROMO 25..77 CDD:214605 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.