DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and cbx5

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_988907.2 Gene:cbx5 / 394502 XenbaseID:XB-GENE-972727 Length:200 Species:Xenopus tropicalis


Alignment Length:157 Identity:87/157 - (55%)
Similarity:104/157 - (66%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLST 67
            |:.||:|.|:|.|.|:.|:.|||||:....|||||..|||||:||:.|.:..| ..|||..:..|
 Frog    36 EYVVEKVLDRRVVKGQVEFLLKWKGFSEEHNTWEPDRNLDCPELISEFMKKYK-KVKETDPKAKT 99

  Fly    68 SSTPESIRSKRKSFLEDDTEEQKK------LIGFERGLEASKILGATDSSGHLMFLMKWKGSDHA 126
            .||      |||:. .||.:.:|:      ..|||||||..||:|||||.|.||||||||.||.|
 Frog   100 EST------KRKAG-SDDIKAKKRRESNDIARGFERGLEPEKIIGATDSCGELMFLMKWKDSDEA 157

  Fly   127 DLVPAKLANTRCPQVVIQFYEERLTWH 153
            |||.||.||.:|||:||.|||||||||
 Frog   158 DLVLAKEANVKCPQIVIAFYEERLTWH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 27/48 (56%)
Chromo_shadow 100..151 CDD:279701 37/50 (74%)
cbx5NP_988907.2 CD_HP1alpha_Cbx5 37..85 CDD:349298 26/47 (55%)
CSD_HP1alpha_Cbx5 125..182 CDD:349302 43/56 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7655
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3899
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm47426
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.