DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Oxp

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster


Alignment Length:62 Identity:28/62 - (45%)
Similarity:39/62 - (62%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESLKNNKKETK 62
            :|:.||:...||.:.||.:|..||:|||..:.||||:||| .|..|||::|..|....:|.|
  Fly    20 SEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 24/49 (49%)
Chromo_shadow 100..151 CDD:279701
OxpNP_611240.1 CHROMO 21..72 CDD:237991 25/50 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.