DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Cbx7

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006242082.1 Gene:Cbx7 / 362962 RGDID:735027 Length:251 Species:Rattus norvegicus


Alignment Length:272 Identity:60/272 - (22%)
Similarity:87/272 - (31%) Gaps:112/272 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTS 68
            |:||.:..||...|:.||.:||||:|...:||||.|::..|.|:..:||      ||.|.|.|  
  Rat    11 FAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEE------KEEKDRAS-- 67

  Fly    69 STPESIRSKRKSFLEDDTEEQKKLIGF-ERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAK 132
                                     |: :||.:..::|.....|..|....|.||.:       |
  Rat    68 -------------------------GYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKE-------K 100

  Fly   133 LA-NTRCPQVVIQFYEERLTWHTGSGNGNG--NTNSVNLGSSGGLGSV----------------- 177
            |. :..||              .|:|:..|  ...:..|...|.||..                 
  Rat   101 LCFSLACP--------------LGNGSPKGVVKAGAAELVEKGPLGPTLPFPLRKPHKAHKYLRL 151

  Fly   178 -------GGS-----------GAGDDTAPGSVGTTGGGSNIDGGDEEDPEPASPIGSINQDENIK 224
                   .||           ...:..||..:..||....::...||:.|               
  Rat   152 SHKKFPPCGSHLESHSHRRELSLQESAAPDVLQATGDWEPVEQPPEEEAE--------------- 201

  Fly   225 PDESSELDNGQP 236
                ::|.||.|
  Rat   202 ----ADLTNGPP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 20/47 (43%)
Chromo_shadow 100..151 CDD:279701 10/51 (20%)
Cbx7XP_006242082.1 CHROMO 10..62 CDD:214605 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.