DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Cdyl

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_017456089.1 Gene:Cdyl / 361237 RGDID:1549745 Length:617 Species:Rattus norvegicus


Alignment Length:241 Identity:53/241 - (21%)
Similarity:90/241 - (37%) Gaps:68/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEFSVERVEDKR-TVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESLKNNKKE---- 60
            ||..||.:.||| ...|:|||.::||||...::||||.::| :|.:.|.:|.......:||    
  Rat    53 AETQVESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGTLA 117

  Fly    61 TKKRLSTSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDH 125
            ...|.|.|:..:.|.....|.| ..|..:..::|.:...:.:::|..:.                
  Rat   118 RANRASPSNARKQISRSTHSAL-SKTNPKALVVGKDHESKTNQLLATSQ---------------- 165

  Fly   126 ADLVPAKLANTRCPQVVIQFYEERLTWHTGSGNGNGNTNSVNLGSSGGLGSVGGSGAGDDTAPGS 190
                  |......|.:                   .|..:::|..||....|..|          
  Rat   166 ------KFRKNTAPSL-------------------ANRKNMDLAKSGIKILVPKS---------- 195

  Fly   191 VGTTGGGSNIDGGDEEDPEPASPIGSINQ--DENIKPDESSELDNG 234
              ...|.::|||...|.||      .::|  ::.:.|:.::|...|
  Rat   196 --PIKGRTSIDGFHGESPE------KLDQGAEDTVTPEVTAEKPTG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 22/50 (44%)
Chromo_shadow 100..151 CDD:279701 3/50 (6%)
CdylXP_017456089.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.