DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Su(var)205

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster


Alignment Length:180 Identity:80/180 - (44%)
Similarity:113/180 - (62%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNK--------- 58
            |::||::.|:|...|:.||||||||||.:||||||..||||.|||..:|.|.|:.:         
  Fly    23 EYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKKDR 87

  Fly    59 -------KETKKRLSTSST------------PESIRSKRKSFLEDDTEEQKKLIGFERGLEASKI 104
                   |||:.|.|:|::            |...:|||.:..|.||.......||:|||||.||
  Fly    88 PSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKI 152

  Fly   105 LGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTWHT 154
            |||:|::|.|.||:::||.|.|::||:.:||.:.|::||.||||||:|::
  Fly   153 LGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 29/48 (60%)
Chromo_shadow 100..151 CDD:279701 28/50 (56%)
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 28/47 (60%)
ChSh 141..202 CDD:197638 35/60 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455520
Domainoid 1 1.000 61 1.000 Domainoid score I3809
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3624
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114392at33392
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - mtm4828
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
109.900

Return to query results.
Submit another query.