DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and HP6

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster


Alignment Length:107 Identity:46/107 - (42%)
Similarity:58/107 - (54%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 TSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPA 131
            ||||...::.:.               ||:.|||..:||||.:.||.|.|||:|||.|.|.||||
  Fly     7 TSSTALPVKQRN---------------GFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPA 56

  Fly   132 KLANTRCPQVVIQFYEERLTWHTGSG--------NGNGNTNS 165
            ::.|.||||:||.|||||:.: |..|        ||...|.|
  Fly    57 EVLNVRCPQMVISFYEERIVF-TDEGDEEDLESDNGYETTPS 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605
Chromo_shadow 100..151 CDD:279701 32/50 (64%)
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 32/50 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8516
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.