Sequence 1: | NP_001162713.1 | Gene: | HP1b / 31834 | FlyBaseID: | FBgn0030082 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608842.1 | Gene: | HP6 / 33661 | FlyBaseID: | FBgn0031613 | Length: | 106 | Species: | Drosophila melanogaster |
Alignment Length: | 107 | Identity: | 46/107 - (42%) |
---|---|---|---|
Similarity: | 58/107 - (54%) | Gaps: | 24/107 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 TSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPA 131
Fly 132 KLANTRCPQVVIQFYEERLTWHTGSG--------NGNGNTNS 165 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HP1b | NP_001162713.1 | CHROMO | 3..52 | CDD:214605 | |
Chromo_shadow | 100..151 | CDD:279701 | 32/50 (64%) | ||
HP6 | NP_608842.1 | Chromo_shadow | 25..76 | CDD:279701 | 32/50 (64%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I8516 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1911 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628171at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000191 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR22812 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.920 |