DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and CG8289

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster


Alignment Length:99 Identity:22/99 - (22%)
Similarity:43/99 - (43%) Gaps:24/99 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANF-----------EESLKN 56
            ::.||::.|.........:.::||.|...:::|||.:||.|..||..|           .:.|:.
  Fly   232 QWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQATQENVDVKELRE 296

  Fly    57 NKKETKK-------------RLSTSSTPESIRSK 77
            :.|:|::             |:..||...|.:::
  Fly   297 SPKKTERLVDECYPRTNLHNRIERSSKRSSAKNR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 15/59 (25%)
Chromo_shadow 100..151 CDD:279701
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.