DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and cbx1a

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_956040.2 Gene:cbx1a / 326746 ZFINID:ZDB-GENE-030131-4945 Length:212 Species:Danio rerio


Alignment Length:157 Identity:88/157 - (56%)
Similarity:109/157 - (69%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANF--EESLKNNKKET---K 62
            |:.||:|.|:|.|.||.||.|||||:...:|||||.:|||||||||.:  :..:.::|||:   :
Zfish    49 EYVVEKVLDRRVVKGRVEYLLKWKGFSEEDNTWEPEDNLDCPDLIAEYMTKHKINDDKKESSAKR 113

  Fly    63 KRLSTSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHAD 127
            |...|....|..|.|::.      :||.|..||.|||:..:|:|||||||.||||||||.||.||
Zfish   114 KESDTDGGGEDSRPKKRK------DEQDKPRGFARGLDPERIIGATDSSGELMFLMKWKNSDEAD 172

  Fly   128 LVPAKLANTRCPQVVIQFYEERLTWHT 154
            |||||.||.:||||||.|||||||||:
Zfish   173 LVPAKEANVKCPQVVISFYEERLTWHS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 30/50 (60%)
Chromo_shadow 100..151 CDD:279701 38/50 (76%)
cbx1aNP_956040.2 Chromo 56..96 CDD:278797 26/39 (67%)
Chromo_shadow 145..196 CDD:279701 38/50 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7663
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H89116
Inparanoid 1 1.050 183 1.000 Inparanoid score I3949
OMA 1 1.010 - - QHG52905
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm25057
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.