DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Cbx8

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_038954.1 Gene:Cbx8 / 30951 MGIID:1353589 Length:362 Species:Mus musculus


Alignment Length:253 Identity:56/253 - (22%)
Similarity:81/253 - (32%) Gaps:88/253 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKN------NKKETK 62
            |:.|.:..:|...||.||.:||||:.:..:||||.||:....|:|.|||..:.      .|:..|
Mouse    11 FAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPK 75

  Fly    63 KRLSTSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHAD 127
            .:..........::|...|..|.|          ||:.                 :.:.|....|
Mouse    76 PKTFLLKAQAKAKAKTYEFRSDST----------RGIR-----------------IPYPGRSPQD 113

  Fly   128 LVPAKLANTRCPQVVIQFYEERLTWHTGSGNGNGNTNSVNLGSSGGLGSVGGSGAGDDTAPGSVG 192
            |.....|.                      .|..||         ||           ..|||..
Mouse   114 LASTSRAR----------------------EGLRNT---------GL-----------PPPGSST 136

  Fly   193 TTGGGSNIDGGDEE--------DPEPASPIGSINQDENIKPD----ESSELDNGQPDA 238
            :|.........|.|        |.:|:|| |..::....||.    :.|:...|:|.|
Mouse   137 STCRADPPRDRDRERDRGTSRVDDKPSSP-GDSSKKRGPKPRKEPLDPSQRPLGEPSA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 20/47 (43%)
Chromo_shadow 100..151 CDD:279701 4/50 (8%)
Cbx8NP_038954.1 CHROMO 10..62 CDD:214605 22/50 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..197 32/174 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.