DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Cbx5

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001100267.1 Gene:Cbx5 / 300266 RGDID:1306619 Length:191 Species:Rattus norvegicus


Alignment Length:162 Identity:86/162 - (53%)
Similarity:108/162 - (66%) Gaps:16/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLK------NNK--- 58
            |:.||:|.|:|.|.|:.||.|||||:....|||||.:|||||:||:.|.:..|      |||   
  Rat    19 EYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPRE 83

  Fly    59 --KETKKRLSTSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWK 121
              :..|::.|.|::.:.|:||:|....:|...     |||||||..||:|||||.|.||||||||
  Rat    84 KSEGNKRKSSFSNSADDIKSKKKREQSNDIAR-----GFERGLEPEKIIGATDSCGDLMFLMKWK 143

  Fly   122 GSDHADLVPAKLANTRCPQVVIQFYEERLTWH 153
            .:|.||||.||.||.:|||:||.|||||||||
  Rat   144 DTDEADLVLAKEANVKCPQIVIAFYEERLTWH 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 28/48 (58%)
Chromo_shadow 100..151 CDD:279701 36/50 (72%)
Cbx5NP_001100267.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 28/48 (58%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 42/56 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7583
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3956
OMA 1 1.010 - - QHG52905
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm44379
orthoMCL 1 0.900 - - OOG6_104220
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.