DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Cdyl2

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:242 Identity:60/242 - (24%)
Similarity:81/242 - (33%) Gaps:81/242 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VERVEDKR-TVNGRTEYYLKWKGYPRSENTWEPVEN-LDCPDLIANFE--ESLKNNKKETKKRLS 66
            |||:.||| ...|:.||.::||||..:|:||||..: |.|.:.|..|.  ...|:.|.::.|:..
  Rat    57 VERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHLPKDKKVKSGKQAG 121

  Fly    67 TSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPA 131
            .|                      ||:...|.|...::                   .|..|.|.
  Rat   122 AS----------------------KLLRDARSLPVERL-------------------SHRPLEPG 145

  Fly   132 KLANTRCPQVVIQFYEERLTWHTGSGNGNGNTNSVNLGSSGGLGSVGGSGAGDDTAPGSVG--TT 194
            |..:|                       :.....||  |.......|.||...|.|..:|.  ||
  Rat   146 KSKST-----------------------SHKRKRVN--SPLSRSKKGSSGKAPDRATKTVSYRTT 185

  Fly   195 GGGSNIDGGDEEDPEPASPIGSINQDENIKPDESSELDNG--QPDAD 239
            ..|..|      .|...:..|..|.|...:.|| |...||  |||.:
  Rat   186 PSGLQI------MPLKKAQNGLENGDAGSEKDE-SHFGNGSHQPDLE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 22/49 (45%)
Chromo_shadow 100..151 CDD:279701 5/50 (10%)
Cdyl2XP_017456726.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.