DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Mphosph8

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001017375.2 Gene:Mphosph8 / 290270 RGDID:1305133 Length:851 Species:Rattus norvegicus


Alignment Length:179 Identity:42/179 - (23%)
Similarity:69/179 - (38%) Gaps:56/179 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESLKNN---------- 57
            |.|||:.|.:...|:..|.::||||...::||||..:| ||.:::..|.:.:..|          
  Rat    59 FEVERILDMKCEGGKNLYKVRWKGYTSDDDTWEPEVHLEDCKEVLLEFRKKVAENKAKAVRKDIQ 123

  Fly    58 ----------------------------KKETKKRLSTSSTPESIRSKR------KSFLEDDTEE 88
                                        ||:.|.:.....:|:.:|.||      |...:.:.|.
  Rat   124 KLSLNNDIFEADSDIDQQGDTKEDTSPRKKKKKIKYKEDKSPDDLRKKRAKMGKLKDKFKTELES 188

  Fly    89 QKKLIGFE-----RGLEASKILGATDS----SGHLMFLMKWKGSDHADL 128
            ..:::||:     |.||..:.|  .||    ...:....|.|.:|..||
  Rat   189 TSEILGFDVKTKKRILEVKEEL--KDSKKPKKDEIKETKKTKRADIRDL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 19/48 (40%)
Chromo_shadow 100..151 CDD:279701 9/33 (27%)
Mphosph8NP_001017375.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..54
CHROMO 58..109 CDD:214605 19/49 (39%)
Histone H3K9me3 binding. /evidence=ECO:0000250|UniProtKB:Q99549 80..87 4/6 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 7/40 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..302
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..428
ANK 586..710 CDD:238125
ANK 1 591..620
ANK repeat 594..622 CDD:293786
Ank_2 597..686 CDD:289560
ANK repeat 624..655 CDD:293786
ANK 2 624..653
ANK repeat 657..686 CDD:293786
ANK 3 657..686
ANK 4 690..719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.