DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and chp1

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_593666.1 Gene:chp1 / 2542239 PomBaseID:SPAC18G6.02c Length:960 Species:Schizosaccharomyces pombe


Alignment Length:231 Identity:53/231 - (22%)
Similarity:84/231 - (36%) Gaps:67/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERV-EDKRTVNGRTEYYLKWKGYPRSENTWEPVENL-------------------------D 42
            :.||.: .|:...||..|||:||.||...:|||||.:||                         |
pombe    22 YEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKWKKRKKLIAKGLLEPFD 86

  Fly    43 CPD--------------------------LIANFEESLKNNKKETKKRLSTSSTPESIRSKRKSF 81
            ..|                          |....:|..|..:|:..:|:.|.:..|  ..:....
pombe    87 AEDNEAKKMKREKEILRQQRQKRKSELTQLSQKVKEKFKKMRKKPARRIVTIANDE--EEEDDQT 149

  Fly    82 LEDDTEEQKKLIG--FERGL-----EASKILGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCP 139
            :::|..|:|.:.|  .||.|     ..|...|.|....:..:|.:|.....:.|:...|::...|
pombe   150 MDEDAFERKSMQGELKERNLTDKTSTLSTSFGETSPDVNPFYLSEWPTVTDSILLSKSLSSDAIP 214

  Fly   140 QVVIQFYEERLTWHTGSGNGN---GNTNSVNLGSSG 172
               ::..|.:.|....|.:.|   |..||.||.::|
pombe   215 ---LKNGEIKSTMLMPSDSDNSVPGIQNSNNLENTG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 22/99 (22%)
Chromo_shadow 100..151 CDD:279701 9/50 (18%)
chp1NP_593666.1 CHROMO 21..>64 CDD:214605 19/41 (46%)
RRM 224..>371 CDD:223796 8/24 (33%)
RRM_SF 313..373 CDD:240668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3374
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.