DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and swi6

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_593449.1 Gene:swi6 / 2541633 PomBaseID:SPAC664.01c Length:328 Species:Schizosaccharomyces pombe


Alignment Length:249 Identity:54/249 - (21%)
Similarity:76/249 - (30%) Gaps:103/249 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTV--NGRTEYYLKWKGY-PRSENTWEPVENLD-CPDLI-ANFEESLKNNKKETK 62
            |:.||:|...|..  .|..||.|||:|| ..|:|||....:.. |..|| |.:.|.....:...:
pombe    80 EYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKR 144

  Fly    63 KRLSTSSTPESIRSKRKSFLEDDTEEQK-----------KLIGF---------ERGLEASKILGA 107
            ||.:....||:.....||...|:.:..|           |.|.|         |.|..:.:..|.
pombe   145 KRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGH 209

  Fly   108 TDS-------------------------------------------------------------- 110
            .:|                                                              
pombe   210 IESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVS 274

  Fly   111 ---------SGHLMFLMKWKG---SDHADLVPAKLANTRCPQVVIQFYEERLTW 152
                     .|.|...:.||.   |.|    |:.:.|.:|||.::||||..||:
pombe   275 SIDTIERKDDGTLEIYLTWKNGAISHH----PSTITNKKCPQKMLQFYESHLTF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 21/53 (40%)
Chromo_shadow 100..151 CDD:279701 17/124 (14%)
swi6NP_593449.1 CHROMO 85..134 CDD:237991 18/48 (38%)
ChSh 261..326 CDD:197638 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8954
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.