DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and hpl-1

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_510199.1 Gene:hpl-1 / 181450 WormBaseID:WBGene00001995 Length:184 Species:Caenorhabditis elegans


Alignment Length:152 Identity:59/152 - (38%)
Similarity:82/152 - (53%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRL--- 65
            |.||:|.:||...|.:|||:||:|:|.||.:|||:|||.|..:|..:|:...  |:.|:||.   
 Worm    37 FVVEKVLNKRLTRGGSEYYIKWQGFPESECSWEPIENLQCDRMIQEYEKEAA--KRTTRKRRYSP 99

  Fly    66 --STSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDHADL 128
              ||||:.|         |:..|.::      ..|.....|:|.|.:.|.|.||.|: ..|...|
 Worm   100 QPSTSSSAE---------LQPSTSDE------WAGKTLKTIIGITKAPGELHFLCKF-SDDSVHL 148

  Fly   129 VPAKLANTRCPQVVIQFYEERL 150
            :|.:.||.|.|..||:|||.||
 Worm   149 IPLREANVRFPSQVIKFYETRL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 24/47 (51%)
Chromo_shadow 100..151 CDD:279701 22/51 (43%)
hpl-1NP_510199.1 CD_HP1_like 36..85 CDD:349316 24/47 (51%)
ChSh 114..174 CDD:197638 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161955
Domainoid 1 1.000 66 1.000 Domainoid score I6523
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3624
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - mtm4828
orthoMCL 1 0.900 - - OOG6_104220
Panther 1 1.100 - - LDO PTHR22812
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8954
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.