DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and set-31

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_506569.1 Gene:set-31 / 179939 WormBaseID:WBGene00007615 Length:503 Species:Caenorhabditis elegans


Alignment Length:124 Identity:27/124 - (21%)
Similarity:53/124 - (42%) Gaps:40/124 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EESLKNNKKETKK--RLSTSST----------PESIRS-----------KRKSFLEDDTEE---- 88
            :.::|.|..:::|  ::||.:|          .:.:||           |..::...||||    
 Worm    16 KNAIKKNASKSRKCDKISTQNTGKVDTEFYEVQDIVRSRIEGREIQYTVKWTNWNGGDTEEAERR 80

  Fly    89 ---QKKLIGF-ERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVI 143
               .:||:|: .|.|::|.:.       :|.|.::...:..:|||  ...||..|..::
 Worm    81 LVCTEKLMGYAARTLKSSYVT-------NLDFFLRNLDTALSDLV--FFTNTLIPLSIV 130

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity