DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and cec-5

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001370694.1 Gene:cec-5 / 177537 WormBaseID:WBGene00017993 Length:374 Species:Caenorhabditis elegans


Alignment Length:115 Identity:29/115 - (25%)
Similarity:57/115 - (49%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTE--YYLKWKGYPRSENTWEPVEN--LDCPDLIANFEESLKNN----KK 59
            :|:||::...|....:.:  :.:.|:|||...:..|..||  .:|.||:..:::|....    ||
 Worm   114 DFAVEKIIAHRFSGKKNKPLFLVMWRGYPNPVSHSEMWENELSNCKDLLEAYKDSHDMKPPPVKK 178

  Fly    60 ETKKRLSTSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATD 109
            ..||:.|..|..:|.:||.....:::.||:.|....::..:::|...:.|
 Worm   179 SNKKKGSKKSPKKSAKSKDDDSSDEEEEEEVKEKSPKKSSKSTKRAASDD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 14/52 (27%)
Chromo_shadow 100..151 CDD:279701 2/10 (20%)
cec-5NP_001370694.1 CD_CSD 115..167 CDD:421697 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.