DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and hpl-2

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001022654.1 Gene:hpl-2 / 176506 WormBaseID:WBGene00001996 Length:303 Species:Caenorhabditis elegans


Alignment Length:139 Identity:51/139 - (36%)
Similarity:79/139 - (56%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVN-GRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLST 67
            |.||:|.||||.. ||.|:.::|:|:|.|:::|||.|||.|.:::..||......:|..:||.|.
 Worm    19 FMVEKVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFEREFSKREKPIRKRHSQ 83

  Fly    68 SSTPESIRSKRKSFLEDDTEEQKKLIGFER----GLEASKILGATDSSGHLMFLMKWKGSDHADL 128
            ...|    |:.::..|:|.:|:|:....::    |.:...|:|.|...|.|.||.|: ..|.|.|
 Worm    84 KPEP----SEDQADPEEDKDEKKETNQNDKFSLEGKQLKCIVGLTKGPGELHFLCKF-SDDTARL 143

  Fly   129 VPAKLANTR 137
            :|||..|:|
 Worm   144 LPAKEVNSR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 23/48 (48%)
Chromo_shadow 100..151 CDD:279701 16/38 (42%)
hpl-2NP_001022654.1 CD_HP1_like 18..68 CDD:349316 23/48 (48%)
CD_CSD 109..>153 CDD:391946 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4828
orthoMCL 1 0.900 - - OOG6_104220
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8954
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.