DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and CDYL2

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens


Alignment Length:242 Identity:62/242 - (25%)
Similarity:89/242 - (36%) Gaps:81/242 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VERVEDKR-TVNGRTEYYLKWKGYPRSENTWEPVEN-LDCPDLIANFEESLKNNKKETKKRLSTS 68
            |||:.||| ...|:.||.::||||..:|:||||..: |.|.:.|..| ..|..:|.:..|....|
Human    43 VERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEF-NGLHMSKDKRIKSGKQS 106

  Fly    69 STPESIRSKRKSFLE------------DDTEEQKKLI---------GF-----ERGLEASKILG- 106
            ||.:.:|..|...:|            ..|..::|.|         |:     ..|..|:|.:. 
Human   107 STSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPLAKPKKGYSGKPSSGGDRATKTVSY 171

  Fly   107 -ATDSSGHLMFLMK-WKGSDHADLVPAKLANTRCPQVVIQFYEERLTWHTGSGN----------- 158
             .|.|...:|.|.| ..|.::.|....|              :||   |.|:|:           
Human   172 RTTPSGLQIMPLKKSQNGMENGDAGSEK--------------DER---HFGNGSHQPGLDLNDHV 219

  Fly   159 -----GNGNTNSVNLGSSGGLGSVGGSGAGDDTAPGSVGTTGGGSNI 200
                 |..:.|...| :..||||               ..|.||.|:
Human   220 GEQDMGECDVNHATL-AENGLGS---------------ALTNGGLNL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 22/47 (47%)
Chromo_shadow 100..151 CDD:279701 12/53 (23%)
CDYL2XP_011521168.1 CHROMO 40..89 CDD:214605 21/45 (47%)
crotonase-like 286..482 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.