DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and CDYL2

DIOPT Version :10

Sequence 1:NP_572521.2 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens


Alignment Length:117 Identity:24/117 - (20%)
Similarity:39/117 - (33%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LTTSLLLSLQNNPILNQTISNFPPTFSITSKTEPEPSIPIQIPQ----RISSTSTVPFSSEGSAF 99
            :|:||.||...|.||....:..                   |||    ::.:|....||...|..
Human    70 MTSSLGLSFLLNLILGMKFTYL-------------------IPQNKYIQLFTTILSFFSGVLSLL 115

  Fly   100 KPYRNTHVFNSISSESMSSMCTSHEASLEHMSSASLAMFPTSSTAQSDISRL 151
            :...:|.....::.....:.|...|.|:|.:|.......|.|......::.|
Human   116 ECKLSTSSCTCLNIHKSDNECKESENSIEDISLPECTAMPRSIVRAHTVNSL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_572521.2 CD_HP1_like 3..52 CDD:349281 6/12 (50%)
CSD 99..150 CDD:349275 8/50 (16%)
CDYL2XP_011521168.1 CD_CDY 42..91 CDD:349284 8/20 (40%)
crotonase-like 286..482 CDD:119339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.