DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and Cbx4

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_031651.2 Gene:Cbx4 / 12418 MGIID:1195985 Length:551 Species:Mus musculus


Alignment Length:243 Identity:52/243 - (21%)
Similarity:73/243 - (30%) Gaps:100/243 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTS 68
            |:||.:|.||...||.||.:||:|:....|||||.||:..|.|:..|:                 
Mouse    11 FAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQ----------------- 58

  Fly    69 STPESIRSKRKSFLEDDTEEQKKLIGF-ERG-------------LEASKIL-GATDSSGHLMFLM 118
                            :.|.|::|:|: :||             ...|.:| |..|||.      
Mouse    59 ----------------NRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSA------ 101

  Fly   119 KWKGSDHADLVPAKLANTRCPQVVIQFYEERLTWHTGS-GNGNGNTNSVNLGSSGGLGSVGGSGA 182
                                        :.|.....|: |.|.|:...:|..............:
Mouse   102 ----------------------------DNRAKLELGTQGKGQGHQYELNSKKHHQYQPHSKERS 138

  Fly   183 GDDTAPGSVGTTGGGSN-----------------IDGGDEEDPEPASP 213
            |....||..|......|                 ..||.:|.|.|..|
Mouse   139 GKPPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 23/47 (49%)
Chromo_shadow 100..151 CDD:279701 7/51 (14%)
Cbx4NP_031651.2 CHROMO 10..62 CDD:214605 23/83 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..152 4/26 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193 6/15 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..244
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..451
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.