DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and CBX1

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001120700.1 Gene:CBX1 / 10951 HGNCID:1551 Length:185 Species:Homo sapiens


Alignment Length:159 Identity:92/159 - (57%)
Similarity:109/159 - (68%) Gaps:13/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLK----NNKKETKK 63
            |:.||:|.|:|.|.|:.||.|||||:...:|||||.||||||||||.|.:|.|    .:|.|..|
Human    20 EYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGK 84

  Fly    64 RLSTSSTP---ESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATDSSGHLMFLMKWKGSDH 125
            |.:.|.:.   |..:.|:|.      ||.:|..||.||||..:|:|||||||.||||||||.||.
Human    85 RKADSDSEDKGEESKPKKKK------EESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDE 143

  Fly   126 ADLVPAKLANTRCPQVVIQFYEERLTWHT 154
            |||||||.||.:||||||.|||||||||:
Human   144 ADLVPAKEANVKCPQVVISFYEERLTWHS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 31/48 (65%)
Chromo_shadow 100..151 CDD:279701 39/50 (78%)
CBX1NP_001120700.1 CD_HP1beta_Cbx1 20..69 CDD:349297 31/48 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 24/66 (36%)
CSD_HP1beta_Cbx1 112..169 CDD:349301 44/56 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7775
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H89116
Inparanoid 1 1.050 176 1.000 Inparanoid score I4048
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52905
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm40254
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.