DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1b and cbx3

DIOPT Version :9

Sequence 1:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_017949990.2 Gene:cbx3 / 100038121 XenbaseID:XB-GENE-492315 Length:227 Species:Xenopus tropicalis


Alignment Length:161 Identity:92/161 - (57%)
Similarity:114/161 - (70%) Gaps:21/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLST 67
            ||.||:|.|:|.|||:.||||||||:..|:|||||.||||||:||    |:..|::|..|::   
 Frog    72 EFVVEKVLDRRVVNGKVEYYLKWKGFTDSDNTWEPEENLDCPELI----EAFLNSQKAGKEK--- 129

  Fly    68 SSTPESIRSKRKSFLEDDTEEQK---------KLIGFERGLEASKILGATDSSGHLMFLMKWKGS 123
               |:|  :||||..:.::|:.|         |..||.|||:..:|:|||||||.||||||||.|
 Frog   130 ---PDS--NKRKSVSDSESEDSKSKKKRETVDKPRGFARGLDPERIIGATDSSGELMFLMKWKDS 189

  Fly   124 DHADLVPAKLANTRCPQVVIQFYEERLTWHT 154
            |.|||||||.||.:||||||.|||||||||:
 Frog   190 DEADLVPAKEANVKCPQVVIAFYEERLTWHS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 32/48 (67%)
Chromo_shadow 100..151 CDD:279701 38/50 (76%)
cbx3XP_017949990.2 CD_HP1gamma_Cbx3 72..121 CDD:349299 33/52 (63%)
CSD_HP1beta_Cbx1 160..217 CDD:349301 43/56 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7655
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3899
OMA 1 1.010 - - QHG52905
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm47426
Panther 1 1.100 - - LDO PTHR22812
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8954
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.