DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44325 and Ssk

DIOPT Version :9

Sequence 1:NP_001285034.1 Gene:CG44325 / 31831 FlyBaseID:FBgn0265413 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_649184.1 Gene:Ssk / 40207 FlyBaseID:FBgn0036945 Length:162 Species:Drosophila melanogaster


Alignment Length:141 Identity:36/141 - (25%)
Similarity:67/141 - (47%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLKIIELAIAIACIVLY------ETVG-----NLSLH-----PVIVAGTVGGYTVICGVLLIGH 55
            :.:|.::|.|.:..|.||      |.:|     ||:..     .::.:|.:.|:.:..|...|..
  Fly    10 IFIKALKLIINLVIIFLYRWGDGGEFLGIGGTWNLNEEKSADAEIVASGVMVGFLIYTGCHTIAF 74

  Fly    56 VLNSLVEK--RLNALFSLIGCLLFVASGALVIDEWHG-----GLLNTDRKRQ-AIGAGSLMIINA 112
            ...:...|  ..:.:.:::||::::|.|.:.:..|.|     |.|..:.:|| .|..|||.:|..
  Fly    75 AFGTTKHKGELCDTIMNVVGCIMWIAVGGVALHYWKGYMSDEGFLYVNSERQVGIAMGSLCVIEG 139

  Fly   113 AVFLLDTLCIC 123
            |::||||:..|
  Fly   140 ALYLLDTVLAC 150



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR36692
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.