DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44325 and CG9628

DIOPT Version :9

Sequence 1:NP_001285034.1 Gene:CG44325 / 31831 FlyBaseID:FBgn0265413 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001163442.1 Gene:CG9628 / 39593 FlyBaseID:FBgn0036433 Length:175 Species:Drosophila melanogaster


Alignment Length:135 Identity:39/135 - (28%)
Similarity:61/135 - (45%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLKIIELAIAIACI-VLYETVGNLSLHPVI---VAG----TVGGYTVICGVLLIGHVLNSLVEK 63
            :.:||:||.:.|.|: ::.|...|..|...|   ||.    |.|..|:...:.||..:...|...
  Fly    36 ICIKIVELCLLICCLGLIDEPATNSHLRVFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPW 100

  Fly    64 RLNALFSLIGCLLFVASGALVIDE---------WHGGLLNTDRKRQAIGAGSLMIINAAVFLLDT 119
            |...|::|:..:||||..||:..:         ||.   |..|....:.:.|:.::.:.|||||.
  Fly   101 RTATLWNLVAFVLFVAVTALLFRDWSTTKDRNYWHP---NMHRLDLVMASASIALVTSLVFLLDI 162

  Fly   120 LCICR 124
            |...|
  Fly   163 LITLR 167



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR36692
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.