DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44325 and AgaP_AGAP000963

DIOPT Version :9

Sequence 1:NP_001285034.1 Gene:CG44325 / 31831 FlyBaseID:FBgn0265413 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_309155.3 Gene:AgaP_AGAP000963 / 1270458 VectorBaseID:AGAP000963 Length:131 Species:Anopheles gambiae


Alignment Length:123 Identity:38/123 - (30%)
Similarity:71/123 - (57%) Gaps:5/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKIIELAIAIACIVLYE---TVGNLSLHPVIVAGTVGGYTVICGVLLIGHVLNSLVEKRLNALF 69
            ::|.:||::|:.|..|:.   ..|:| :...:..||..|:.||...::.|:::.:.:.:||:..:
Mosquito    11 IIKFLELSLAVTCTTLHYYSFNDGDL-VTGFLATGTFCGFIVILFTVMAGYLMKAHLHRRLSIFY 74

  Fly    70 SLIGCLLFVASGALVIDEWHGGLLNTDRKRQAIGAGSLMIINAAVFLLDTLCICRTRQ 127
            ||:||:.|:.||..:|:.|... ..|..:..||..||:.:||..:||:||:...|.|:
Mosquito    75 SLLGCVCFLTSGVFIIEAWEHA-FRTRTRDLAITKGSIAVINGVIFLMDTIFTFRERK 131



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR36692
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.