DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32988 and CG32987

DIOPT Version :9

Sequence 1:NP_788008.1 Gene:CG32988 / 318274 FlyBaseID:FBgn0052988 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_788007.1 Gene:CG32987 / 318273 FlyBaseID:FBgn0052987 Length:257 Species:Drosophila melanogaster


Alignment Length:214 Identity:50/214 - (23%)
Similarity:102/214 - (47%) Gaps:9/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FIFRVYLSSVVLCLLSSISWIILSALAVRVYKAIPVPPFVWLILAFIILSVLGCIAQTPALTLLC 105
            ||..:|...::|..::..:||:|....:.:.:.:|.|.:|..::.|:::..:.||.:....:...
  Fly    23 FIRSIYNIGLILIGITVGAWILLMLTHIHLQRYLPFPCYVLALIIFLVMICMHCIPRISYYSPCK 87

  Fly   106 W---GLVLGSLFFLTLFGAYYMHLVRVWVLLIAILVAGSLLALLHLYGAKSPEVLLPNIICTCCI 167
            |   |||   :...||||.:::|.:...::...::....::.||:..||..|:..||..:|:..:
  Fly    88 WFMTGLV---VVCTTLFGCHFIHDLSPLIISFVMIGVALIIMLLNFSGAMCPQEFLPGGVCSTLL 149

  Fly   168 FLLLTVTMIVLLILFLIINDMRYLLALAIVFVILIAFMAPFQARFICGRL---QQVPYGETADCA 229
            .:.|.:.:.::.|:.|....:..|.....:..:::....|.||:|..|||   :.||......|.
  Fly   150 MMALLLVLTIVGIVQLCTGSVELLDTFVSILFLMLIIAIPIQAQFNHGRLNVVEVVPEEHLMVCT 214

  Fly   230 NGIYLHFIFLLSCMLVFAL 248
            ..:|||.:....|:..|.|
  Fly   215 LTLYLHSMMFFFCVCYFIL 233



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.