DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32987 and CG32983

DIOPT Version :9

Sequence 1:NP_788007.1 Gene:CG32987 / 318273 FlyBaseID:FBgn0052987 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_788009.1 Gene:CG32983 / 50434 FlyBaseID:FBgn0052983 Length:250 Species:Drosophila melanogaster


Alignment Length:216 Identity:69/216 - (31%)
Similarity:115/216 - (53%) Gaps:18/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FIRSIYNIGLILIGITVGAWILLMLTHIHLQRYLPFPCYVLALIIFLVMICMHCIPRISYYSP-C 86
            |.|::|...::|...:....:.:....|.:.|.||.|.||..|....::..:.|:| ||...| .
  Fly    22 FARTVYIEAVLLCSASAFPLMFIASLKISIVRILPVPPYVWLLFALAILAVLICLP-ISRVRPLI 85

  Fly    87 KWFMTGLVVVCTTLFGCHFI--HDLSPLIISFVMIGVALIIMLLNFSGAMCPQEFLPG----GVC 145
            .|.|.|.||...||...:::  :|:..|::.|.:  :||::..|.||||.|.:.|||.    ||.
  Fly    86 VWTMVGGVVGLLTLSAAYYVNMYDIPDLVLYFTV--MALVLGGLMFSGAKCRKSFLPNGLVTGVI 148

  Fly   146 STLLMMALLLVLTIVGIVQLCTGSVELLDTFVSILFLMLIIAIPIQAQFNHGRLNVVEVVPEEHL 210
            .|:.::| ||.|:::.:|    .:.....||.::|..:::|.||::|||.||||....:..|.  
  Fly   149 VTIFLVA-LLPLSVLSVV----STRYFFPTFCAVLSALVLIVIPLEAQFMHGRLQYSPLGLEP-- 206

  Fly   211 MVCTLTLYLHSMMFFFCVCYF 231
             :|::.:||:|...|||:|.|
  Fly   207 -ICSMLIYLNSFTLFFCICVF 226



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.