DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32987 and ZC13.2

DIOPT Version :9

Sequence 1:NP_788007.1 Gene:CG32987 / 318273 FlyBaseID:FBgn0052987 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_508172.1 Gene:ZC13.2 / 180438 WormBaseID:WBGene00022503 Length:321 Species:Caenorhabditis elegans


Alignment Length:194 Identity:41/194 - (21%)
Similarity:66/194 - (34%) Gaps:71/194 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IEQLDPMTQFIRSIYNIGLILIGITVGAWILLMLTHIHLQRYLPFPCYVLALIIFLVMICMHCIP 78
            |||: |||          .::||.....|:.::.               ::.|::||:||.    
 Worm   147 IEQV-PMT----------TVIIGDIEFDWLEVIR---------------ISTIVYLVIICF---- 181

  Fly    79 RISYYSPCKWFMTGLVVV----CTTLFGCHFIHDLSPLIISFVMIGVALIIMLLNFSGAM----- 134
                     ||.:|:..:    |..|....|...:..|::.|.:....|:..|:.|...|     
 Worm   182 ---------WFGSGVFFIFTIRCEVLDTAIFNTTILILVVLFQIAHAGLVTSLIFFQREMSWRTL 237

  Fly   135 ------------CPQEFLPGGVCSTLLMMALLLV--------LTIVGIVQLCTGSVELLDTFVS 178
                        |  .|| |.||.||....:..:        .:|..:..||.|..|.|:...|
 Worm   238 SITIGTIVILFCC--AFL-GFVCITLNCGWVKYIDYMHGKKKCSICSLFSLCCGKKEPLEAATS 298



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.