powered by:
Protein Alignment CG32939 and NAT8
DIOPT Version :9
Sequence 1: | NP_788618.1 |
Gene: | CG32939 / 318260 |
FlyBaseID: | FBgn0052939 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003951.3 |
Gene: | NAT8 / 9027 |
HGNCID: | 18069 |
Length: | 227 |
Species: | Homo sapiens |
Alignment Length: | 55 |
Identity: | 11/55 - (20%) |
Similarity: | 22/55 - (40%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 IYRFAIDPHYPCQTIMDPMIKLVVKNCIIGGYASLECTISEWQESERDFYDDFGF 212
::...:|..:..|.|...:::.|::.....||:.:.......|.|....|...||
Human 139 LFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGF 193
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.