DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32939 and NAT8

DIOPT Version :9

Sequence 1:NP_788618.1 Gene:CG32939 / 318260 FlyBaseID:FBgn0052939 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_003951.3 Gene:NAT8 / 9027 HGNCID:18069 Length:227 Species:Homo sapiens


Alignment Length:55 Identity:11/55 - (20%)
Similarity:22/55 - (40%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 IYRFAIDPHYPCQTIMDPMIKLVVKNCIIGGYASLECTISEWQESERDFYDDFGF 212
            ::...:|..:..|.|...:::.|::.....||:.:.......|.|....|...||
Human   139 LFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32939NP_788618.1 None
NAT8NP_003951.3 RimI <101..200 CDD:223532 11/55 (20%)
Acetyltransf_1 113..194 CDD:278980 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.